PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000194.1_g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 267aa    MW: 30222.2 Da    PI: 6.7914
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000194.1_g00020.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.81.1e-49171391128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtd+elv +yL++k++++++++  vi+e+d+yk+ Pw+Lp+++  +ekewyfFs+rd+ky++g+r+nra+  gyWkat
  Itr_sc000194.1_g00020.1  17 LPPGFRFHPTDDELVLHYLCRKCASQPISV-PVIAEIDLYKFAPWQLPEMALYGEKEWYFFSPRDRKYPNGSRPNRAAGLGYWKAT 101
                              79****************************.89***************7666789******************************* PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g dk+v +    + g+kk Lvfy g+ap+g kt+W+mheyrl
  Itr_sc000194.1_g00020.1 102 GADKPVGK----AQGIKKALVFYAGKAPTGIKTNWIMHEYRL 139
                              ******77....78**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-6014165IPR003441NAC domain
PROSITE profilePS5100557.74817165IPR003441NAC domain
PfamPF023652.2E-2618139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MNSGGIQFNR RPELDFLPPG FRFHPTDDEL VLHYLCRKCA SQPISVPVIA EIDLYKFAPW  60
QLPEMALYGE KEWYFFSPRD RKYPNGSRPN RAAGLGYWKA TGADKPVGKA QGIKKALVFY  120
AGKAPTGIKT NWIMHEYRLA NVDRSAGKGH TLRLDDWVLC RIYNKKGILE KYDNVVVADD  180
QKPKLTGFSP NAMLAPPQSN QSEYLHWHTD SSSSSDQMLS SPELAPEKEV QSGSGWDDLD  240
FQLNNFMAAF PADDPFNSFP DILFPLQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-8051712174Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009616658.11e-110PREDICTED: protein ATAF2-like
SwissprotQ9C5981e-101NAC81_ARATH; Protein ATAF2
TrEMBLC7ENF91e-127C7ENF9_IPOBA; NAC1
STRINGVIT_07s0031g02610.t011e-106(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12392481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08790.18e-99NAC family protein